Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABHD15 Rabbit Polyclonal Antibody (HRP)

ABHD15 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q6UXT9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LOC116236

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QTLCHFVLPVAPGPELAREYLQLADDGLVALDWVVGPCVRGRRITSAGGL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_937790

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC136242 Antibody Blocking peptide
orb1460459 500 µg

LOC136242 Antibody Blocking peptide

Sign In for Pricing
View Details
IL-23R, Human (Biotinylated, HEK293, Fc-Avi)
HY-P78856-01 25 µg

IL-23R, Human (Biotinylated, HEK293, Fc-Avi)

Sign In for Pricing
View Details
IL-23R, Human (Biotinylated, HEK293, Fc-Avi)
HY-P78856-02 200 µg

IL-23R, Human (Biotinylated, HEK293, Fc-Avi)

Sign In for Pricing
View Details
Anti Human CD41 Flow Cytometry Monoclonal Clone HIP8 AF647 Ready To Use 100 Tests
IMSAHUCD41HIP8CAF647100 100 Tests

Anti Human CD41 Flow Cytometry Monoclonal Clone HIP8 AF647 Ready To Use 100 Tests

Sign In for Pricing
View Details
PDS5B Antibody, Biotin conjugated
CSB-PA889108LD01HU-01 50 µg

PDS5B Antibody, Biotin conjugated

Sign In for Pricing
View Details
PDS5B Antibody, Biotin conjugated
CSB-PA889108LD01HU-02 100 µg

PDS5B Antibody, Biotin conjugated

Sign In for Pricing
View Details