Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ankrd46 Rabbit Polyclonal Antibody (FITC)

Ankrd46 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AI314978, AI987733, 1110054N06Rik

UniProt

Q8BTZ5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of MOUSE Ankrd46

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FRTTWQEFVEDLGFWRVLLLILVIALLSLGIAYYVSGVLPFVDNQPELVH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_780343

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1orf146 Protein Vector (Human) (pPM-N-D-C-HA)
PV329896 500 ng

C1orf146 Protein Vector (Human) (pPM-N-D-C-HA)

Sign In for Pricing
View Details
Lentiviral human STARD10 sgRNA gene knockout kit - Lentiviral human STARD10 sgRNA gene knockout kit (25)
GTR15382383 1 Vial

Lentiviral human STARD10 sgRNA gene knockout kit - Lentiviral human STARD10 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Human Microtubule-associated protein light chain 3B (LC3B) ELISA Kit
orb3012554-01 48 Tests

Human Microtubule-associated protein light chain 3B (LC3B) ELISA Kit

Sign In for Pricing
View Details
Human Microtubule-associated protein light chain 3B (LC3B) ELISA Kit
orb3012554-02 96 Tests

Human Microtubule-associated protein light chain 3B (LC3B) ELISA Kit

Sign In for Pricing
View Details
Human Microtubule-associated protein light chain 3B (LC3B) ELISA Kit
orb3012554-03 5 x 96 T

Human Microtubule-associated protein light chain 3B (LC3B) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Doublesex- and mab-3-related transcription factor 1 (DMRT1)
MBS1335443-01 0.02 mg (E-Coli)

Recombinant Human Doublesex- and mab-3-related transcription factor 1 (DMRT1)

Sign In for Pricing
View Details