Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DGKA Rabbit Polyclonal Antibody (HRP)

DGKA Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DAGK, DAGK1, DGK-alpha

UniProt

P23743

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DGKA

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSEL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

83kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_963848

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCDHGA3 (G-5) Alexa Fluor® 647
sc-515152 AF647 200 µg/mL

PCDHGA3 (G-5) Alexa Fluor® 647

Sign In for Pricing
View Details
Rat Monoclonal CD25/IL-2R alpha Antibody (PC61.5.3) [DyLight 755]
NB600-710IR 0.25 mL

Rat Monoclonal CD25/IL-2R alpha Antibody (PC61.5.3) [DyLight 755]

Sign In for Pricing
View Details
TMEM222 Human shRNA Lentiviral Particle (Locus ID 84065)
TL306036V 500 µL Each

TMEM222 Human shRNA Lentiviral Particle (Locus ID 84065)

Sign In for Pricing
View Details
Citalopram (CIT) Rapid Tests Cassette
DCIT-102 40 Tests

Citalopram (CIT) Rapid Tests Cassette

Sign In for Pricing
View Details
APOBEC4 (NM_203454) Human Recombinant Protein
PH31735E1 50 µg

APOBEC4 (NM_203454) Human Recombinant Protein

Sign In for Pricing
View Details
CA242 (1A6), mAb, Mouse
V06001-1 1 mg

CA242 (1A6), mAb, Mouse

Sign In for Pricing
View Details