Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHCHD1 Rabbit Polyclonal Antibody (Biotin)

CHCHD1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

C2360, MRP-S37, C10orf34

UniProt

Q96BP2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CHCHD1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MATPSLRGRLARFGNPRKPVLKPNKPLILANRVGERRREKGEATCITEMS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

13

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_976043

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TLR2 Antibody-Biotin (3U29)
TMAY-00203B 100 µg

Anti-TLR2 Antibody-Biotin (3U29)

Sign In for Pricing
View Details
Mouse Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein (NOS1AP) ELISA Kit
MBS282274-01 48 Tests

Mouse Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein (NOS1AP) ELISA Kit

Sign In for Pricing
View Details
Mouse Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein (NOS1AP) ELISA Kit
MBS282274-02 96 Tests

Mouse Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein (NOS1AP) ELISA Kit

Sign In for Pricing
View Details
Mouse Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein (NOS1AP) ELISA Kit
MBS282274-03 5x 96 Tests

Mouse Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein (NOS1AP) ELISA Kit

Sign In for Pricing
View Details
Mouse Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein (NOS1AP) ELISA Kit
MBS282274-04 10x 96 Tests

Mouse Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein (NOS1AP) ELISA Kit

Sign In for Pricing
View Details
4- (Trifluoromethyl) phenyl acetate
orb3031030-01 100 mg

4- (Trifluoromethyl) phenyl acetate

Sign In for Pricing
View Details