Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FITM1 Rabbit Polyclonal Antibody (FITC)

FITM1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FIT1

UniProt

A5D6W6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LOC161247

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YFHQYTHKVVGAAVGTFAWYLTYGSWYHQPWSPGSPGHGLFPRPHSSRKH

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_981947

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gimap5 (NM_001033913) Rat Tagged ORF Clone Lentiviral Particle
RR200155L4V 200 µL

Gimap5 (NM_001033913) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Atp2c2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7124206 1.0 µg DNA

Atp2c2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
DCPS (DCS1, HINT5, m7GpppX Diphosphatase, DCS-1, Hint-related 7meGMP-directed Hydrolase, Histidine Triad Protein Member 5, Scavenger mRNA-decapping Enzyme DcpS, HSPC015) APC
MBS6375733-01 0.1 mL

DCPS (DCS1, HINT5, m7GpppX Diphosphatase, DCS-1, Hint-related 7meGMP-directed Hydrolase, Histidine Triad Protein Member 5, Scavenger mRNA-decapping Enzyme DcpS, HSPC015) APC

Sign In for Pricing
View Details
DCPS (DCS1, HINT5, m7GpppX Diphosphatase, DCS-1, Hint-related 7meGMP-directed Hydrolase, Histidine Triad Protein Member 5, Scavenger mRNA-decapping Enzyme DcpS, HSPC015) APC
MBS6375733-02 5x 0.1 mL

DCPS (DCS1, HINT5, m7GpppX Diphosphatase, DCS-1, Hint-related 7meGMP-directed Hydrolase, Histidine Triad Protein Member 5, Scavenger mRNA-decapping Enzyme DcpS, HSPC015) APC

Sign In for Pricing
View Details
TACR2 Recombinant Protein (Mouse)
RP177050 100 µg

TACR2 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Anti-Human Plasma Albumin IgG
ALBH12-A 100 µL

Anti-Human Plasma Albumin IgG

Sign In for Pricing
View Details