Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1orf102 Rabbit Polyclonal Antibody (HRP)

C1orf102 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NOR1, C1orf102

UniProt

A6NIN9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C1orf102

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ARKVLNDIISTMFNRKFMEELFKPQELYSKKALRTVYERLAHASIMKLNQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_996668

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Breast
CR562517 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
ELMO1 Recombinant Rabbit Monoclonal Antibody [JG34-59]
ET7108-06 100 µL

ELMO1 Recombinant Rabbit Monoclonal Antibody [JG34-59]

Sign In for Pricing
View Details
Human LOXL3 activation kit by CRISPRa
GA113661 1 Kit

Human LOXL3 activation kit by CRISPRa

Sign In for Pricing
View Details
Human MTERFD2 (MTERF4) activation kit by CRISPRa
GA115131 1 Kit

Human MTERFD2 (MTERF4) activation kit by CRISPRa

Sign In for Pricing
View Details
Luteinizing Hormone beta (LHB) (NM_000894) Human Over-expression Lysate
LY424466 100 µg

Luteinizing Hormone beta (LHB) (NM_000894) Human Over-expression Lysate

Sign In for Pricing
View Details
SGTA Human Gene Knockout Kit (CRISPR)
KN201429 1 Kit

SGTA Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details