Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TUBA3E Rabbit Polyclonal Antibody (FITC)

TUBA3E Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q6PEY2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human TBA3E

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RLSVDYSKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVD

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_997195

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gag Antibody
orb843251 2 mg

Gag Antibody

Sign In for Pricing
View Details
PtX Mouse Anti-SARS CoV-2 Nucleocapsid Protein (N12.8) Recombinant Antibody
orb1736852 100 µg

PtX Mouse Anti-SARS CoV-2 Nucleocapsid Protein (N12.8) Recombinant Antibody

Sign In for Pricing
View Details
Low Sample Volume ELISA Kit for Vascular Endothelial Growth Factor 121 (VEGF121)
TRV-0064373-01 24 Tests

Low Sample Volume ELISA Kit for Vascular Endothelial Growth Factor 121 (VEGF121)

Sign In for Pricing
View Details
Low Sample Volume ELISA Kit for Vascular Endothelial Growth Factor 121 (VEGF121)
TRV-0064373-02 48 Tests

Low Sample Volume ELISA Kit for Vascular Endothelial Growth Factor 121 (VEGF121)

Sign In for Pricing
View Details
Low Sample Volume ELISA Kit for Vascular Endothelial Growth Factor 121 (VEGF121)
TRV-0064373-03 96 Tests

Low Sample Volume ELISA Kit for Vascular Endothelial Growth Factor 121 (VEGF121)

Sign In for Pricing
View Details
Low Sample Volume ELISA Kit for Vascular Endothelial Growth Factor 121 (VEGF121)
TRV-0064373-04 5x 96 Tests

Low Sample Volume ELISA Kit for Vascular Endothelial Growth Factor 121 (VEGF121)

Sign In for Pricing
View Details