Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C20orf132 Rabbit Polyclonal Antibody (HRP)

C20orf132 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C20orf131, C20orf132

UniProt

Q9H579

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C20orf132

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PHLENLDTIIKLPLRFQRLGHLVALMALLCGDPQEKVAEEAAEGIHSLLH

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse

Tested Applications

WB

NCBI Accession Number

NP_998797

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Serum Amyloid P (APCS) Human Gene Knockout Kit (CRISPR)
KN202802RB 1 Kit

Serum Amyloid P (APCS) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FGFR2 Recombinant Rabbit Monoclonal Antibody [JM10-60]
ET1703-78 100 µL

FGFR2 Recombinant Rabbit Monoclonal Antibody [JM10-60]

Sign In for Pricing
View Details
Tripartite motif containing protein 77 (TRIM77) Human Gene Knockout Kit (CRISPR)
KN428363 1 Kit

Tripartite motif containing protein 77 (TRIM77) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GPR55 (NM_005683) Human Over-expression Lysate
LY401734 100 µg

GPR55 (NM_005683) Human Over-expression Lysate

Sign In for Pricing
View Details
Bglap Mouse Gene Knockout Kit (CRISPR)
KN502150 1 Kit

Bglap Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HEF1 (NEDD9) (NM_001142393) Human Recombinant Protein
TP327437L 1 mg

HEF1 (NEDD9) (NM_001142393) Human Recombinant Protein

Sign In for Pricing
View Details