Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLA2G4E Rabbit Polyclonal Antibody (FITC)

PLA2G4E Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FLJ45651, MGC126633, MGC126661

UniProt

C9JK77

Immunogen

The immunogen is a synthetic peptide directed towards the c terminal region of human PLA2G4E

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TFFPLINDTFRKYKAPGVERSPEELEQGQVDIYGPKTPYATKELTYTEAT

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

96kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001073959

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ube2n / Ubiquitin-conjugating enzyme E2 N ELISA Kit
MBS2905987-01 48 Well

Mouse Ube2n / Ubiquitin-conjugating enzyme E2 N ELISA Kit

Sign In for Pricing
View Details
Mouse Ube2n / Ubiquitin-conjugating enzyme E2 N ELISA Kit
MBS2905987-02 96 Well

Mouse Ube2n / Ubiquitin-conjugating enzyme E2 N ELISA Kit

Sign In for Pricing
View Details
Mouse Ube2n / Ubiquitin-conjugating enzyme E2 N ELISA Kit
MBS2905987-03 5x 96 Well

Mouse Ube2n / Ubiquitin-conjugating enzyme E2 N ELISA Kit

Sign In for Pricing
View Details
Mouse Ube2n / Ubiquitin-conjugating enzyme E2 N ELISA Kit
MBS2905987-04 10x 96 Well

Mouse Ube2n / Ubiquitin-conjugating enzyme E2 N ELISA Kit

Sign In for Pricing
View Details
HMGCS1 Peptide
DF12100-BP 1 mg

HMGCS1 Peptide

Sign In for Pricing
View Details
Recombinant Human S100A8 Protein (His Tag)
MBS2569016-01 0.02 mg

Recombinant Human S100A8 Protein (His Tag)

Sign In for Pricing
View Details