Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL13RA2 Rabbit Polyclonal Antibody (FITC)

IL13RA2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CT19, IL-13R, IL13BP, CD213A2

UniProt

Q14627

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human IL13RA2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLL

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

EAX0262

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Titin Antibody
NBP1-88071 0.1 mL

Rabbit Polyclonal Titin Antibody

Sign In for Pricing
View Details
KLK11 shRNA (h) Lentiviral Particles
sc-41540-V 200 µL

KLK11 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
KIF11 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-8177R-BF594 100 µL

KIF11 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Tm9sf3 Rabbit Polyclonal Antibody
orb580745 100 µL

Tm9sf3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Iffo1 shRNA (UAS) - Lentiviral mouse Iffo1 shRNA (UAS, RFP) (100)
GTR15240912 1 Vial

Lentiviral mouse Iffo1 shRNA (UAS) - Lentiviral mouse Iffo1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Rat Acyl-coenzyme A synthetase ACSM3, mitochondrial (ACSM3) ELISA kit
GTR10463532 96 Well

Rat Acyl-coenzyme A synthetase ACSM3, mitochondrial (ACSM3) ELISA kit

Sign In for Pricing
View Details