Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL13RA2 Rabbit Polyclonal Antibody (HRP)

IL13RA2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CT19, IL-13R, IL13BP, CD213A2

UniProt

Q14627

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human IL13RA2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLL

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

EAX0262

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human C10orf82 shRNA (UAS) - Lentiviral human C10orf82 shRNA (UAS, RFP) plasmid
GTR15133969 1 Vial

Lentiviral human C10orf82 shRNA (UAS) - Lentiviral human C10orf82 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Recombinant Human Tie-2 (C-Fc)
PHH2100-01 10 µg

Recombinant Human Tie-2 (C-Fc)

Sign In for Pricing
View Details
Recombinant Human Tie-2 (C-Fc)
PHH2100-02 50 µg

Recombinant Human Tie-2 (C-Fc)

Sign In for Pricing
View Details
Recombinant Human Tie-2 (C-Fc)
PHH2100-03 500 µg

Recombinant Human Tie-2 (C-Fc)

Sign In for Pricing
View Details
Prednisolone acetate
FP27133-01 2 g

Prednisolone acetate

Sign In for Pricing
View Details
Prednisolone acetate
FP27133-02 5 g

Prednisolone acetate

Sign In for Pricing
View Details