Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL13RA2 Rabbit Polyclonal Antibody (HRP)

IL13RA2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CT19, IL-13R, IL13BP, CD213A2

UniProt

Q14627

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human IL13RA2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GQNIGCRFPYLEASDYKDFYICVNGSSENKPIRSSYFTFQLQNIVKPLPP

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000631

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GDF3, ID (Growth/Differentiation Factor 3, GDF-3, UNQ222/PRO248) (PE)
MBS6479190-01 0.2 mL

GDF3, ID (Growth/Differentiation Factor 3, GDF-3, UNQ222/PRO248) (PE)

Sign In for Pricing
View Details
GDF3, ID (Growth/Differentiation Factor 3, GDF-3, UNQ222/PRO248) (PE)
MBS6479190-02 5x 0.2 mL

GDF3, ID (Growth/Differentiation Factor 3, GDF-3, UNQ222/PRO248) (PE)

Sign In for Pricing
View Details
RSL1D1 (Ribosomal L1 Domain-containing Protein 1, CATX11, CATX-11, Cellular Senescence-inhibited Gene Protein, CSIG, L12, PBK1, Protein PBK1, UTP30)
132868 50 µg

RSL1D1 (Ribosomal L1 Domain-containing Protein 1, CATX11, CATX-11, Cellular Senescence-inhibited Gene Protein, CSIG, L12, PBK1, Protein PBK1, UTP30)

Sign In for Pricing
View Details
CYP2A13 Antibody, HRP conjugated
A77328-100UL 100 µL

CYP2A13 Antibody, HRP conjugated

Sign In for Pricing
View Details
CD226 Rabbit mAb
C06577-100uL*2 2x 100μL

CD226 Rabbit mAb

Sign In for Pricing
View Details
WNT16 (Protein Wnt-16)
171421 50 µg

WNT16 (Protein Wnt-16)

Sign In for Pricing
View Details