Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDE1C Rabbit Polyclonal Antibody (HRP)

PDE1C Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Hcam3, DFNA74, hCam-3, cam-PDE 1C

UniProt

P54750

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PDE1C

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DLKKNIEYAASVLEAVYIDETRRLLDTEDELSDIQTDSVPSEVRDWLAST

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005011

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cel (NM_009885) Mouse Tagged ORF Clone Lentiviral Particle
MR209300L3V 200 µL

Cel (NM_009885) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Defa20 (NM_183268) Mouse Tagged ORF Clone Lentiviral Particle
MR219861L3V 200 µL

Defa20 (NM_183268) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
KAP22.1 Rabbit pAb, BF700 conjugated
orb2859029 100 µL

KAP22.1 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal BMP-3b/GDF-10 Antibody
NBP2-92033-0.02mL 0.02 mL

Rabbit Polyclonal BMP-3b/GDF-10 Antibody

Sign In for Pricing
View Details
Phospho-Tau (Thr217) Mouse Monoclonal Antibody (Biotin)
orb1727953 100 µL

Phospho-Tau (Thr217) Mouse Monoclonal Antibody (Biotin)

Sign In for Pricing
View Details
Human ZNF341 knockout cell line
ABC-KH17493 1 Vial

Human ZNF341 knockout cell line

Sign In for Pricing
View Details