Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARHGAP28 Rabbit Polyclonal Antibody (HRP)

ARHGAP28 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DKFZp686A2038, FLJ10312

UniProt

Q9P2N2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TKAKDILAKFQYENSHGSSECIKIQNQRLYEIGGNIGEHCLDPDAYILDV

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001010000

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Liver
CS710345 5x 5 µm

Tissue FFPE Sections, Liver

Sign In for Pricing
View Details
Mouse Slc6a9 activation kit by CRISPRa
GA201642 1 Kit

Mouse Slc6a9 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Blocks, Thyroid gland
CB610263 1 Block

Frozen Tissue Blocks, Thyroid gland

Sign In for Pricing
View Details
Bax (NM_007527) Mouse Tagged ORF Clone
MG201841 10 µg

Bax (NM_007527) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ZNF213 Mouse Monoclonal Antibody [Clone ID: OTI1A12]
CF810318 100 µg

ZNF213 Mouse Monoclonal Antibody [Clone ID: OTI1A12]

Sign In for Pricing
View Details
CCK4 (PTK7) (NM_152881) Human Recombinant Protein
TP320322 20 µg

CCK4 (PTK7) (NM_152881) Human Recombinant Protein

Sign In for Pricing
View Details