Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AURKC Rabbit Polyclonal Antibody (FITC)

AURKC Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AIE2, AIK3, ARK3, AurC, SPGF5, STK13, HEL-S-90, aurora-C

UniProt

Q9UQB9

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence PRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGK

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGK

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

NCBI Accession Number

NP_001015878

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Mercaptopyruvate Sulfurtransferase (MPST) ELISA Kit
MBS4501144-01 48 Tests

Mouse Mercaptopyruvate Sulfurtransferase (MPST) ELISA Kit

Sign In for Pricing
View Details
Mouse Mercaptopyruvate Sulfurtransferase (MPST) ELISA Kit
MBS4501144-02 96 Tests

Mouse Mercaptopyruvate Sulfurtransferase (MPST) ELISA Kit

Sign In for Pricing
View Details
Mouse Mercaptopyruvate Sulfurtransferase (MPST) ELISA Kit
MBS4501144-03 5x 96 Tests

Mouse Mercaptopyruvate Sulfurtransferase (MPST) ELISA Kit

Sign In for Pricing
View Details
Mouse Mercaptopyruvate Sulfurtransferase (MPST) ELISA Kit
MBS4501144-04 10x 96 Tests

Mouse Mercaptopyruvate Sulfurtransferase (MPST) ELISA Kit

Sign In for Pricing
View Details
Human NHLRC4 qPCR Primer Pair
QH71053S 200 Tests

Human NHLRC4 qPCR Primer Pair

Sign In for Pricing
View Details
TRNAS5 Protein Vector (Human) (pPM-C-His)
PV140241 500 ng

TRNAS5 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details