Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AURKC Rabbit Polyclonal Antibody (HRP)

AURKC Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AIE2, AIK3, ARK3, AurC, SPGF5, STK13, HEL-S-90, aurora-C

UniProt

Q9UQB9

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence PRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGK

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGK

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

NCBI Accession Number

NP_001015878

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp672 ORF Vector (Mouse) (pORF)
ORF062497 1.0 µg DNA

Zfp672 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Plasmid Miniprep Columns, Capless spin columns, Blue fixing rings
NAEB181809A 500 Pieces/Case:500 Pieces/ PACKS:1 PACKS/CASE

Plasmid Miniprep Columns, Capless spin columns, Blue fixing rings

Sign In for Pricing
View Details
SREBF1 (Sterol Regulatory Element Binding Transcription Factor 1, SREBP-1c, SREBP1, bHLHd1) (MaxLight 650)
252086-ML650 100 µL

SREBF1 (Sterol Regulatory Element Binding Transcription Factor 1, SREBP-1c, SREBP1, bHLHd1) (MaxLight 650)

Sign In for Pricing
View Details
Calretinin/CALB2 Rabbit Polyclonal Antibody (Fluoro488)
orb3078284 100 µg

Calretinin/CALB2 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
Mouse Macrophage-Derived Chemokine (MDC; CCL22) ELISA Kit
YP-W28161-01 48 Tests

Mouse Macrophage-Derived Chemokine (MDC; CCL22) ELISA Kit

Sign In for Pricing
View Details
Mouse Macrophage-Derived Chemokine (MDC; CCL22) ELISA Kit
YP-W28161-02 96 Tests

Mouse Macrophage-Derived Chemokine (MDC; CCL22) ELISA Kit

Sign In for Pricing
View Details