Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADAM2 Rabbit Polyclonal Antibody (Biotin)

ADAM2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CT15, FTNB, PH30, CRYN1, CRYN2, PH-30b, PH30-beta

UniProt

Q99965

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NFDSLPVQITVPEKIRSIIKEGIESQASYKIVIEGKPYTVNLMQKNFLPH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

81kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_001455

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZG16B (NM_145252) Human Tagged Lenti ORF Clone
RC202244L4 10 µg

ZG16B (NM_145252) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
APC-Cy7 Linked Polyclonal Antibody to Asporin (ASPN)
MBS2117418-01 0.1 mL

APC-Cy7 Linked Polyclonal Antibody to Asporin (ASPN)

Sign In for Pricing
View Details
APC-Cy7 Linked Polyclonal Antibody to Asporin (ASPN)
MBS2117418-02 0.2 mL

APC-Cy7 Linked Polyclonal Antibody to Asporin (ASPN)

Sign In for Pricing
View Details
APC-Cy7 Linked Polyclonal Antibody to Asporin (ASPN)
MBS2117418-03 0.5 mL

APC-Cy7 Linked Polyclonal Antibody to Asporin (ASPN)

Sign In for Pricing
View Details
APC-Cy7 Linked Polyclonal Antibody to Asporin (ASPN)
MBS2117418-04 1 mL

APC-Cy7 Linked Polyclonal Antibody to Asporin (ASPN)

Sign In for Pricing
View Details
APC-Cy7 Linked Polyclonal Antibody to Asporin (ASPN)
MBS2117418-05 5 mL

APC-Cy7 Linked Polyclonal Antibody to Asporin (ASPN)

Sign In for Pricing
View Details