Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CREM Rabbit Polyclonal Antibody (HRP)

CREM Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ICER, CREM-2, hCREM-2

UniProt

Q03060

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human CREM

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYTATGDMPTYQIRAP

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCDHB3 (Protocadherin beta-3, PCDH-beta-3, PCDH-BETA3) (PE)
130968-PE 100 µL

PCDHB3 (Protocadherin beta-3, PCDH-beta-3, PCDH-BETA3) (PE)

Sign In for Pricing
View Details
UBE2D2 (Ubiquitin-conjugating Enzyme E2 D2, UBC4, UBC5B, UBCH4, UBCH5B, Ubiquitin Carrier Protein D2, Ubiquitin-conjugating Enzyme E2(17)KB 2, Ubiquitin-conjugating Enzyme E2-17kD 2, Ubiquitin-protein Ligase D2, p53-regulated Ubiquitin-conjugating Enzyme
MBS6214627-01 0.1 mL

UBE2D2 (Ubiquitin-conjugating Enzyme E2 D2, UBC4, UBC5B, UBCH4, UBCH5B, Ubiquitin Carrier Protein D2, Ubiquitin-conjugating Enzyme E2(17)KB 2, Ubiquitin-conjugating Enzyme E2-17kD 2, Ubiquitin-protein Ligase D2, p53-regulated Ubiquitin-conjugating Enzyme

Sign In for Pricing
View Details
UBE2D2 (Ubiquitin-conjugating Enzyme E2 D2, UBC4, UBC5B, UBCH4, UBCH5B, Ubiquitin Carrier Protein D2, Ubiquitin-conjugating Enzyme E2(17)KB 2, Ubiquitin-conjugating Enzyme E2-17kD 2, Ubiquitin-protein Ligase D2, p53-regulated Ubiquitin-conjugating Enzyme
MBS6214627-02 5x 0.1 mL

UBE2D2 (Ubiquitin-conjugating Enzyme E2 D2, UBC4, UBC5B, UBCH4, UBCH5B, Ubiquitin Carrier Protein D2, Ubiquitin-conjugating Enzyme E2(17)KB 2, Ubiquitin-conjugating Enzyme E2-17kD 2, Ubiquitin-protein Ligase D2, p53-regulated Ubiquitin-conjugating Enzyme

Sign In for Pricing
View Details
Anti-AS160/TBC1D4 Antibody Picoband®, iFluor647 Conjugate
A02004-3-iFluor647 100 µg

Anti-AS160/TBC1D4 Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details
Bacterial/Permeability-Increasing Protein, Human Neutrophil (BPI, Cap57/57kD Antimicrobial Protein)
208748 50 µg

Bacterial/Permeability-Increasing Protein, Human Neutrophil (BPI, Cap57/57kD Antimicrobial Protein)

Sign In for Pricing
View Details
VPS4A Protein Vector (Rat) (pPB-N-His)
PV316071 500 ng

VPS4A Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details