Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSNK2A2 Rabbit Polyclonal Antibody (HRP)

CSNK2A2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CK2A2, CSNK2A1, CK2alpha'

UniProt

P19784

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CSNK2A2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALD

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001887

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Alkaline Phosphatase/ALPP Antibody (H17E2) [Alexa Fluor 350]
NB600-750AF350 0.1 mL

Mouse Monoclonal Alkaline Phosphatase/ALPP Antibody (H17E2) [Alexa Fluor 350]

Sign In for Pricing
View Details
Mouse Homeobox protein Hox-D10 (HOXD10) Elisa Kit
EK730997 96 Well

Mouse Homeobox protein Hox-D10 (HOXD10) Elisa Kit

Sign In for Pricing
View Details
Il1rap-set siRNA/shRNA/RNAi Lentivector (Rat)
24851096 4x 500 ng

Il1rap-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Lentiviral mouse Arhgef16 shRNA (UAS) - Lentiviral mouse Arhgef16 shRNA (UAS) (100)
GTR15250218 1 Vial

Lentiviral mouse Arhgef16 shRNA (UAS) - Lentiviral mouse Arhgef16 shRNA (UAS) (100)

Sign In for Pricing
View Details
Human Legionella antibody IgA (LP Ab-IgA) ELISA Kit
QY-E02698 96 Tests

Human Legionella antibody IgA (LP Ab-IgA) ELISA Kit

Sign In for Pricing
View Details
Mediator of RNA polymerase II Transcription subunit 26 (MED26) Mouse ELISA Kit
E9076 96 Tests

Mediator of RNA polymerase II Transcription subunit 26 (MED26) Mouse ELISA Kit

Sign In for Pricing
View Details