Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSNK2A2 Rabbit Polyclonal Antibody (Biotin)

CSNK2A2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CK2A2, CSNK2A1, CK2alpha'

UniProt

P19784

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CSNK2A2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_001887

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster Surfactant Associated Protein B ELISA Kit
MBS099388-01 48 Well

Hamster Surfactant Associated Protein B ELISA Kit

Sign In for Pricing
View Details
Hamster Surfactant Associated Protein B ELISA Kit
MBS099388-02 96 Well

Hamster Surfactant Associated Protein B ELISA Kit

Sign In for Pricing
View Details
Hamster Surfactant Associated Protein B ELISA Kit
MBS099388-03 5x 96 Well

Hamster Surfactant Associated Protein B ELISA Kit

Sign In for Pricing
View Details
Hamster Surfactant Associated Protein B ELISA Kit
MBS099388-04 10x 96 Well

Hamster Surfactant Associated Protein B ELISA Kit

Sign In for Pricing
View Details
Olfr558 siRNA (m)
sc-60504 10 µM

Olfr558 siRNA (m)

Sign In for Pricing
View Details
G-Protein Coupled Receptor 151 (GPR151) Antibody
abx328163-01 50 µg

G-Protein Coupled Receptor 151 (GPR151) Antibody

Sign In for Pricing
View Details