Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANBP5 Rabbit Polyclonal Antibody (Biotin)

RANBP5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

IMB3, Pse1, imp5, KPNB3, RANBP5

UniProt

O00410

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RANBP5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GNNQWPEGLKFLFDSVSSQNVGLREAALHIFWNFPGIFGNQQQHYLDVIK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

125kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002262

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC-conjugated Goat Rabbit lgG Antibody
orb2303107-01 100 µL

FITC-conjugated Goat Rabbit lgG Antibody

Sign In for Pricing
View Details
FITC-conjugated Goat Rabbit lgG Antibody
orb2303107-02 1 mL

FITC-conjugated Goat Rabbit lgG Antibody

Sign In for Pricing
View Details
ITGB5 (Integrin beta-5, Integrin, beta 5, FLJ26658) (HRP)
128640-HRP 100 µL

ITGB5 (Integrin beta-5, Integrin, beta 5, FLJ26658) (HRP)

Sign In for Pricing
View Details
Fruit fly Adh Rabbit Polyclonal Antibody (HRP)
orb2572789 200 µL

Fruit fly Adh Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Recombinant Saccharum officinarum Uncharacterized protein ycf70 (orf81)
MBS1304929-01 0.02 mg (E-Coli)

Recombinant Saccharum officinarum Uncharacterized protein ycf70 (orf81)

Sign In for Pricing
View Details
Recombinant Saccharum officinarum Uncharacterized protein ycf70 (orf81)
MBS1304929-02 0.1 mg (E-Coli)

Recombinant Saccharum officinarum Uncharacterized protein ycf70 (orf81)

Sign In for Pricing
View Details