Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ldha Rabbit Polyclonal Antibody (FITC)

Ldha Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CDK1, Ldh1

UniProt

P04642

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Ldha

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPV

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_058721

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKR1D1 Human siRNA Oligo Duplex (Locus ID 6718)
SR304578 1 Kit

AKR1D1 Human siRNA Oligo Duplex (Locus ID 6718)

Sign In for Pricing
View Details
6-Chloro-2-fluoro-3- (methylthio) benzoic acid
PC1013625-01 250 mg

6-Chloro-2-fluoro-3- (methylthio) benzoic acid

Sign In for Pricing
View Details
6-Chloro-2-fluoro-3- (methylthio) benzoic acid
PC1013625-02 500 mg

6-Chloro-2-fluoro-3- (methylthio) benzoic acid

Sign In for Pricing
View Details
6-Chloro-2-fluoro-3- (methylthio) benzoic acid
PC1013625-03 1 g

6-Chloro-2-fluoro-3- (methylthio) benzoic acid

Sign In for Pricing
View Details
6-Chloro-2-fluoro-3- (methylthio) benzoic acid
PC1013625-04 5 g

6-Chloro-2-fluoro-3- (methylthio) benzoic acid

Sign In for Pricing
View Details
SMEK2, CT (SMEK2, KIAA1387, PP4R3B, PPP4R3B, Serine/threonine-protein phosphatase 4 regulatory subunit 3B, SMEK homolog 2) (APC) discontinued
042042-APC 200 µL

SMEK2, CT (SMEK2, KIAA1387, PP4R3B, PPP4R3B, Serine/threonine-protein phosphatase 4 regulatory subunit 3B, SMEK homolog 2) (APC) discontinued

Sign In for Pricing
View Details