Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ldha Rabbit Polyclonal Antibody (HRP)

Ldha Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CDK1, Ldh1

UniProt

P04642

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Ldha

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPV

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_058721

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CARD12/NLRC4 Antibody Picoband® Fluoro594 Conjugated
PB9673-Fluoro594 100 µg/Vial

Anti-CARD12/NLRC4 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
Recombinant Huntingtin Interacting Protein 12 (HIP12)
MBS2029311-01 0.01 mg

Recombinant Huntingtin Interacting Protein 12 (HIP12)

Sign In for Pricing
View Details
Recombinant Huntingtin Interacting Protein 12 (HIP12)
MBS2029311-02 0.05 mg

Recombinant Huntingtin Interacting Protein 12 (HIP12)

Sign In for Pricing
View Details
Recombinant Huntingtin Interacting Protein 12 (HIP12)
MBS2029311-03 0.1 mg

Recombinant Huntingtin Interacting Protein 12 (HIP12)

Sign In for Pricing
View Details
Recombinant Huntingtin Interacting Protein 12 (HIP12)
MBS2029311-04 0.2 mg

Recombinant Huntingtin Interacting Protein 12 (HIP12)

Sign In for Pricing
View Details
Recombinant Huntingtin Interacting Protein 12 (HIP12)
MBS2029311-05 0.5 mg

Recombinant Huntingtin Interacting Protein 12 (HIP12)

Sign In for Pricing
View Details