Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pcyt2 Rabbit Polyclonal Antibody (Biotin)

Pcyt2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ET, 1110033E03Rik

UniProt

Q922E4

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRMLLVTK

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_077191

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Camel Karyopherin Alpha 4 (KPNA4) ELISA Kit
MBS9926273-01 48 Well

Camel Karyopherin Alpha 4 (KPNA4) ELISA Kit

Sign In for Pricing
View Details
Camel Karyopherin Alpha 4 (KPNA4) ELISA Kit
MBS9926273-02 96 Well

Camel Karyopherin Alpha 4 (KPNA4) ELISA Kit

Sign In for Pricing
View Details
Camel Karyopherin Alpha 4 (KPNA4) ELISA Kit
MBS9926273-03 5x 96 Well

Camel Karyopherin Alpha 4 (KPNA4) ELISA Kit

Sign In for Pricing
View Details
Camel Karyopherin Alpha 4 (KPNA4) ELISA Kit
MBS9926273-04 10x 96 Well

Camel Karyopherin Alpha 4 (KPNA4) ELISA Kit

Sign In for Pricing
View Details
Tfap2c Mouse siRNA Oligo Duplex (Locus ID 21420)
SR414684 1 Kit

Tfap2c Mouse siRNA Oligo Duplex (Locus ID 21420)

Sign In for Pricing
View Details
FGF4 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-1256R-PerCP-Cy5.5 100 µL

FGF4 Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details