Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNP1 Rabbit Polyclonal Antibody (HRP)

TNP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TP1

UniProt

P09430

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TNP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRN

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

6kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_003275

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human T Cell Receptor Interacting Molecule/TRIM/TCRIM/TRAT1 (C-6His)
orb1648659-01 10 µg

Recombinant Human T Cell Receptor Interacting Molecule/TRIM/TCRIM/TRAT1 (C-6His)

Sign In for Pricing
View Details
Recombinant Human T Cell Receptor Interacting Molecule/TRIM/TCRIM/TRAT1 (C-6His)
orb1648659-02 50 µg

Recombinant Human T Cell Receptor Interacting Molecule/TRIM/TCRIM/TRAT1 (C-6His)

Sign In for Pricing
View Details
Recombinant Human T Cell Receptor Interacting Molecule/TRIM/TCRIM/TRAT1 (C-6His)
orb1648659-03 500 µg

Recombinant Human T Cell Receptor Interacting Molecule/TRIM/TCRIM/TRAT1 (C-6His)

Sign In for Pricing
View Details
Recombinant Human T Cell Receptor Interacting Molecule/TRIM/TCRIM/TRAT1 (C-6His)
orb1648659-04 1 mg

Recombinant Human T Cell Receptor Interacting Molecule/TRIM/TCRIM/TRAT1 (C-6His)

Sign In for Pricing
View Details
Human Adducin 2 (ADD2) ELISA Kit
201-12-3086 96 Tests

Human Adducin 2 (ADD2) ELISA Kit

Sign In for Pricing
View Details
Anti-CD69 Antibody Picoband®, Cy3 Conjugate
A00529-2-Cy3 100 µg/Vial

Anti-CD69 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details