Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDXK Rabbit Polyclonal Antibody (HRP)

PDXK Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PKH, PNK, HMSN6C, PRED79, C21orf97, HEL-S-1a, C21orf124

UniProt

O00764

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PDXK

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNK

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

IHC, WB

NCBI Accession Number

NP_003672

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM83A, ID (D283) (FAM83A, TSGP, Protein FAM83A, Tumor antigen BJ-TSA-9, Tumor-specific gene expressed in prostate protein) (MaxLight 405)
MBS6297949-01 0.1 mL

FAM83A, ID (D283) (FAM83A, TSGP, Protein FAM83A, Tumor antigen BJ-TSA-9, Tumor-specific gene expressed in prostate protein) (MaxLight 405)

Sign In for Pricing
View Details
FAM83A, ID (D283) (FAM83A, TSGP, Protein FAM83A, Tumor antigen BJ-TSA-9, Tumor-specific gene expressed in prostate protein) (MaxLight 405)
MBS6297949-02 5x 0.1 mL

FAM83A, ID (D283) (FAM83A, TSGP, Protein FAM83A, Tumor antigen BJ-TSA-9, Tumor-specific gene expressed in prostate protein) (MaxLight 405)

Sign In for Pricing
View Details
DnaJ/HSP40 Homolog Subfamily B, Member 9 (DNAJB9) Magnetic Luminex Assay Kit
LKU606272 96 Tests

DnaJ/HSP40 Homolog Subfamily B, Member 9 (DNAJB9) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
(Z) -3-Cyclopropylbut-2-enoic acid
OR909195-01 1 g

(Z) -3-Cyclopropylbut-2-enoic acid

Sign In for Pricing
View Details
(Z) -3-Cyclopropylbut-2-enoic acid
OR909195-02 5 g

(Z) -3-Cyclopropylbut-2-enoic acid

Sign In for Pricing
View Details
SLC66A1 (NM_001040125) Human Tagged ORF Clone
RG221672 10 µg

SLC66A1 (NM_001040125) Human Tagged ORF Clone

Sign In for Pricing
View Details