Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDXK Rabbit Polyclonal Antibody (FITC)

PDXK Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PKH, PNK, HMSN6C, PRED79, C21orf97, HEL-S-1a, C21orf124

UniProt

O00764

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PDXK

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRN

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003672

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Epidermal Growth Factor Receptor 2 Extracellular Domain ELISA Kit
MBS031573-01 48 Well

Bovine Epidermal Growth Factor Receptor 2 Extracellular Domain ELISA Kit

Sign In for Pricing
View Details
Bovine Epidermal Growth Factor Receptor 2 Extracellular Domain ELISA Kit
MBS031573-02 96 Well

Bovine Epidermal Growth Factor Receptor 2 Extracellular Domain ELISA Kit

Sign In for Pricing
View Details
Bovine Epidermal Growth Factor Receptor 2 Extracellular Domain ELISA Kit
MBS031573-03 5x 96 Well

Bovine Epidermal Growth Factor Receptor 2 Extracellular Domain ELISA Kit

Sign In for Pricing
View Details
Bovine Epidermal Growth Factor Receptor 2 Extracellular Domain ELISA Kit
MBS031573-04 10x 96 Well

Bovine Epidermal Growth Factor Receptor 2 Extracellular Domain ELISA Kit

Sign In for Pricing
View Details
MUC2 (Mucin 2, Oligomeric Mucus/gel-Forming, MLP, SMUC) (MaxLight 550)
MBS6218154-01 0.1 mL

MUC2 (Mucin 2, Oligomeric Mucus/gel-Forming, MLP, SMUC) (MaxLight 550)

Sign In for Pricing
View Details
MUC2 (Mucin 2, Oligomeric Mucus/gel-Forming, MLP, SMUC) (MaxLight 550)
MBS6218154-02 5x 0.1 mL

MUC2 (Mucin 2, Oligomeric Mucus/gel-Forming, MLP, SMUC) (MaxLight 550)

Sign In for Pricing
View Details