Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUP155 Rabbit Polyclonal Antibody (HRP)

NUP155 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

N155, ATFB15

UniProt

O75694

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NUP155

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ISLHLQDICPLLYSTDDAICSKANELLQRSRQVQNKTEKERMLRESLKEY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

147kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004289

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL21P122 CRISPRa sgRNA lentivector (set of three targets)(Human)
41000121 3x 1.0µg DNA

RPL21P122 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Mouse IL-15 Recombinant Protein
PROTP48346-10ug 10 µg

Mouse IL-15 Recombinant Protein

Sign In for Pricing
View Details
TTC37 Lentiviral Activation Particles (m)
sc-432297-LAC 200 µL

TTC37 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
NR6A1 antibody
70R-18958 50 μL

NR6A1 antibody

Sign In for Pricing
View Details
HDAC2 (Histone Deacetylase 2) BioAssayTM ELISA Kit (Mouse) discontinued
356235-01 48 Tests

HDAC2 (Histone Deacetylase 2) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
HDAC2 (Histone Deacetylase 2) BioAssayTM ELISA Kit (Mouse) discontinued
356235-02 96 Tests

HDAC2 (Histone Deacetylase 2) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details