Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUP155 Rabbit Polyclonal Antibody (HRP)

NUP155 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

N155, ATFB15

UniProt

O75694

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NUP155

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ISLHLQDICPLLYSTDDAICSKANELLQRSRQVQNKTEKERMLRESLKEY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

147kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004289

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to CD300 Antigen Like Family Member C (CD300c)
TRV-0003442-01 20 µL

Monoclonal Antibody to CD300 Antigen Like Family Member C (CD300c)

Sign In for Pricing
View Details
Monoclonal Antibody to CD300 Antigen Like Family Member C (CD300c)
TRV-0003442-02 100 µL

Monoclonal Antibody to CD300 Antigen Like Family Member C (CD300c)

Sign In for Pricing
View Details
Monoclonal Antibody to CD300 Antigen Like Family Member C (CD300c)
TRV-0003442-03 200 µL

Monoclonal Antibody to CD300 Antigen Like Family Member C (CD300c)

Sign In for Pricing
View Details
Monoclonal Antibody to CD300 Antigen Like Family Member C (CD300c)
TRV-0003442-04 1 mL

Monoclonal Antibody to CD300 Antigen Like Family Member C (CD300c)

Sign In for Pricing
View Details
ZNF205 (NM_001042428) Human Over-expression Lysate
E45H05167-2 20 µg

ZNF205 (NM_001042428) Human Over-expression Lysate

Sign In for Pricing
View Details
Gpr173 Rat siRNA Oligo Duplex (Locus ID 64021)
SR502544 1 Kit

Gpr173 Rat siRNA Oligo Duplex (Locus ID 64021)

Sign In for Pricing
View Details