Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COIL Rabbit Polyclonal Antibody (HRP)

COIL Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CLN80, p80-coilin

UniProt

P38432

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human COIL

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DYSLLPLLAAAPQVGEKIAFKLLELTSSYSPDVSDYKEGRILSHNPETQQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004636

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNB2L1 Protein Vector (Human) (pPB-C-His)
PV018025 500 ng

GNB2L1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
MHC Class II Rabbit Polyclonal Antibody (AP)
orb924836 100 µL

MHC Class II Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Chicken Transforming Growth factor β1, TGF-β1 ELISA kit
CSB-E09875Ch-01 48 Tests

Chicken Transforming Growth factor β1, TGF-β1 ELISA kit

Sign In for Pricing
View Details
Chicken Transforming Growth factor β1, TGF-β1 ELISA kit
CSB-E09875Ch-02 96 Tests

Chicken Transforming Growth factor β1, TGF-β1 ELISA kit

Sign In for Pricing
View Details
Chicken Transforming Growth factor β1, TGF-β1 ELISA kit
CSB-E09875Ch-03 5x 96 Tests

Chicken Transforming Growth factor β1, TGF-β1 ELISA kit

Sign In for Pricing
View Details
Chicken Transforming Growth factor β1, TGF-β1 ELISA kit
CSB-E09875Ch-04 10x 96 Tests

Chicken Transforming Growth factor β1, TGF-β1 ELISA kit

Sign In for Pricing
View Details