Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cdkn3 Rabbit Polyclonal Antibody (Biotin)

Cdkn3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

K, KAP, 2410006H10Rik

UniProt

Q810P3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LKSYGIQDVFVFCTRGELSKYRVPNLLDLYQQYGIVTHHHPIPDGGTPDI

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_082498

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RHOX6 (Putative Uncharacterized Protein, Reproductive Homeobox 6)
490533 100 µL

RHOX6 (Putative Uncharacterized Protein, Reproductive Homeobox 6)

Sign In for Pricing
View Details
VEGFB167 Polyclonal Antibody, FITC Conjugated
bs-10071R-FITC 100 µL

VEGFB167 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Colloidal Gold Conjugated Allomyrina dichotoma Lectin (Japanese Beetle) -Allo A-,  5nm
GP-6401-5 1 mL

Colloidal Gold Conjugated Allomyrina dichotoma Lectin (Japanese Beetle) -Allo A-, 5nm

Sign In for Pricing
View Details
MYOZ1 AAV Vector (Mouse) (CMV)
31314104 1 µg

MYOZ1 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Lentiviral mouse Foxp3 shRNA (UAS) - Lentiviral mouse Foxp3 shRNA (UAS, iRFP) (25)
GTR15142274 1 Vial

Lentiviral mouse Foxp3 shRNA (UAS) - Lentiviral mouse Foxp3 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
TLR6 (Toll-like Receptor 6, CD286)
252757 100 µg

TLR6 (Toll-like Receptor 6, CD286)

Sign In for Pricing
View Details