Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cdkn3 Rabbit Polyclonal Antibody (HRP)

Cdkn3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

K, KAP, 2410006H10Rik

UniProt

Q810P3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LKSYGIQDVFVFCTRGELSKYRVPNLLDLYQQYGIVTHHHPIPDGGTPDI

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_082498

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sar1B Polyclonal Antibody
JOT-AP08130-01 20 µL

Sar1B Polyclonal Antibody

Sign In for Pricing
View Details
Sar1B Polyclonal Antibody
JOT-AP08130-02 50 μL

Sar1B Polyclonal Antibody

Sign In for Pricing
View Details
Sar1B Polyclonal Antibody
JOT-AP08130-03 100 µL

Sar1B Polyclonal Antibody

Sign In for Pricing
View Details
Animal FSH ELISA kit
orb624320-01 48 Tests

Animal FSH ELISA kit

Sign In for Pricing
View Details
Animal FSH ELISA kit
orb624320-02 96 Tests

Animal FSH ELISA kit

Sign In for Pricing
View Details
Gne 3'UTR Luciferase Stable Cell Line
TU205223 1.0 mL

Gne 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details