Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TUBA3C Rabbit Polyclonal Antibody (HRP)

TUBA3C Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TUBA2, bA408E5.3

UniProt

Q13748

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TUBA3C

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005992

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Parotid Tissue Slides (Tumor) - (Dry Ice)
NBP2-77643 5 Slides

Parotid Tissue Slides (Tumor) - (Dry Ice)

Sign In for Pricing
View Details
Pex11a Mouse qPCR Primer Pair (NM_011068)
MP210735 200 Reactions

Pex11a Mouse qPCR Primer Pair (NM_011068)

Sign In for Pricing
View Details
Anti-SFXN1 Antibody Picoband®
A11524-1-carrier-free 100 µg/Vial

Anti-SFXN1 Antibody Picoband®

Sign In for Pricing
View Details
XLF Rabbit Monoclonal Antibody
E10G22181 100 µL

XLF Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Rtbdn 3'UTR Lenti-reporter-Luc Vector
42856084 1.0 µg

Rtbdn 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
KLF14 CRISPRa sgRNA lentivector (set of three targets)(Rat)
25744126 3x 1.0µg DNA

KLF14 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details