Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prkaa1 Rabbit Polyclonal Antibody (HRP)

Prkaa1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AMPK, AI194361, AI450832, AL024255, AMPKalpha1, C130083N04Rik

UniProt

Q5EG47

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: STPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRH

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001013385

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal vWF-A2 Antibody [DyLight 550]
NBP3-06544R 0.1 mL

Rabbit Polyclonal vWF-A2 Antibody [DyLight 550]

Sign In for Pricing
View Details
ANKS1B Protein Vector (Human) (pPM-C-HA)
PV001755 500 ng

ANKS1B Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Mthfd2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4703006 1.0 µg DNA

Mthfd2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
IKBKE Mouse Monoclonal Antibody [Clone ID: OTI5D4]
TA807618S 30 µL

IKBKE Mouse Monoclonal Antibody [Clone ID: OTI5D4]

Sign In for Pricing
View Details
Mouse Ephrin B2 (EFNB2) Protein
abx653292-01 10 µg

Mouse Ephrin B2 (EFNB2) Protein

Sign In for Pricing
View Details
Mouse Ephrin B2 (EFNB2) Protein
abx653292-02 50 µg

Mouse Ephrin B2 (EFNB2) Protein

Sign In for Pricing
View Details