Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prkaa1 Rabbit Polyclonal Antibody (HRP)

Prkaa1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AMPK, AI194361, AI450832, AL024255, AMPKalpha1, C130083N04Rik

UniProt

Q5EG47

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: STPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRH

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001013385

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human BEX3 shRNA (UAS) - Lentiviral human BEX3 shRNA (UAS, RFP) (25)
GTR15077603 1 Vial

Lentiviral human BEX3 shRNA (UAS) - Lentiviral human BEX3 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
TMPRSS5 Human Gene Knockout Kit (CRISPR)
KN423774 1 Kit

TMPRSS5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD155; PVR; NECL5 Protein (C-His, Human)
P513885 100 µg

CD155; PVR; NECL5 Protein (C-His, Human)

Sign In for Pricing
View Details
Ainsliaside B
TBZ30075 unit

Ainsliaside B

Sign In for Pricing
View Details
KIAA1618 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV811977 1.0 µg DNA

KIAA1618 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
CACFD1 Adenovirus (Human)
14871051 1.0 mL

CACFD1 Adenovirus (Human)

Sign In for Pricing
View Details