Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKAA1 Rabbit Polyclonal Antibody (FITC)

PRKAA1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AMPK, AMPKa1, AMPK alpha 1

UniProt

Q13131

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PRKAA1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMID

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006242

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Hydroxydecanoate. sodium salt
MBS565660-01 100 mg

5-Hydroxydecanoate. sodium salt

Sign In for Pricing
View Details
5-Hydroxydecanoate. sodium salt
MBS565660-02 500 mg

5-Hydroxydecanoate. sodium salt

Sign In for Pricing
View Details
5-Hydroxydecanoate. sodium salt
MBS565660-03 5x 500 mg

5-Hydroxydecanoate. sodium salt

Sign In for Pricing
View Details
C1QB (Complement C1q Subcomponent Subunit B, Complement Component 1, q Subcomponent, B Chain)
476702 100 µL

C1QB (Complement C1q Subcomponent Subunit B, Complement Component 1, q Subcomponent, B Chain)

Sign In for Pricing
View Details
5' 6-FAM / 3' TAMRA
FP-179-20 20 to 29 nmol

5' 6-FAM / 3' TAMRA

Sign In for Pricing
View Details
Recombinant PRRSV GP4/Glycoprotein 4 Protein, N-His
MBS1578703-01 0.1 mg

Recombinant PRRSV GP4/Glycoprotein 4 Protein, N-His

Sign In for Pricing
View Details