Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BID, Human

BID Protein, Human expresses in E. coli. The BH3-only protein BID, a pro-apoptotic member of the Bcl-2 family, was initially discovered through binding to both pro-apoptotic Bax and anti-apoptotic Bcl-2. BID is activated in the BCL-2-regulated or mitochondrial apoptosis pathway and acts as a switch between the extrinsic and intrinsic cell death pathways[1].

Product Specifications

Product Name Alternative

BID Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bid-protein-human.html

Purity

98.0

Smiles

MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD

Molecular Formula

637 (Gene_ID) P55957 (M1-D195) (Accession)

Molecular Weight

Approximately 20.0 kDa

References & Citations

[1]Billen LP, et al. Bid: a Bax-like BH3 protein. Oncogene. 2008;27 Suppl 1:S93-S104.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLOD1 AAV Vector (Mouse) (CMV)
37024104 1 µg

PLOD1 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Recombinant Elliptorhina sp. Hypertrehalosaemic factor
MBS1213887-01 0.05 mg (E-Coli)

Recombinant Elliptorhina sp. Hypertrehalosaemic factor

Sign In for Pricing
View Details
Recombinant Elliptorhina sp. Hypertrehalosaemic factor
MBS1213887-02 0.2 mg (E-Coli)

Recombinant Elliptorhina sp. Hypertrehalosaemic factor

Sign In for Pricing
View Details
Recombinant Elliptorhina sp. Hypertrehalosaemic factor
MBS1213887-03 0.5 mg (E-Coli)

Recombinant Elliptorhina sp. Hypertrehalosaemic factor

Sign In for Pricing
View Details
Recombinant Elliptorhina sp. Hypertrehalosaemic factor
MBS1213887-04 0.05 mg (Yeast)

Recombinant Elliptorhina sp. Hypertrehalosaemic factor

Sign In for Pricing
View Details
Recombinant Elliptorhina sp. Hypertrehalosaemic factor
MBS1213887-05 0.05 mg (Baculovirus)

Recombinant Elliptorhina sp. Hypertrehalosaemic factor

Sign In for Pricing
View Details