Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKAA1 Rabbit Polyclonal Antibody (HRP)

PRKAA1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AMPK, AMPKa1, AMPK alpha 1

UniProt

Q13131

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PRKAA1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMID

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006242

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Galectin 9 Rabbit pAb, PE-Cy5 conjugated
orb2865427 100 µL

Galectin 9 Rabbit pAb, PE-Cy5 conjugated

Sign In for Pricing
View Details
Integrin Alpha V + Beta 6 Antibody, AbBy Fluor™ 594 Conjugated
bs-5791R-BF594-TR 20 µL

Integrin Alpha V + Beta 6 Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
ZWILCH (Zwilch Kinetochore Protein, Protein Zwilch Homolog, hZwilch, KNTC1AP) (APC)
135850-APC 100 µL

ZWILCH (Zwilch Kinetochore Protein, Protein Zwilch Homolog, hZwilch, KNTC1AP) (APC)

Sign In for Pricing
View Details
Tissue FFPE Sections, Fallopian tube
CS800353 5x 5 µm

Tissue FFPE Sections, Fallopian tube

Sign In for Pricing
View Details
CPB2 CRISPRa sgRNA lentivector (set of three targets)(Human)
16741121 3x 1.0µg DNA

CPB2 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Anti-Adrenomedullin (human)
ABS 027-01-04 400 µL

Anti-Adrenomedullin (human)

Sign In for Pricing
View Details