Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

St6galnac2 Rabbit Polyclonal Antibody (HRP)

St6galnac2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Siat7b

UniProt

Q6ZYN8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SAILGVPVPEGPDKGDRPHIYFGPETSASKFKLLHPDFIGYLTERFLKSK

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001026822

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal SERCA2 ATPase Antibody (10F0M9)
NBP3-15429-100ul 100 µL

Rabbit Monoclonal SERCA2 ATPase Antibody (10F0M9)

Sign In for Pricing
View Details
Hepatitis B Core (HBV Core, HBcAg), Recombinant, Yeast (Pichia)
H1905 1 mg

Hepatitis B Core (HBV Core, HBcAg), Recombinant, Yeast (Pichia)

Sign In for Pricing
View Details
Rgs17 (NM_001107459) Rat Tagged ORF Clone
RR200621 10 µg

Rgs17 (NM_001107459) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Cy3 Linked Polyclonal Antibody to Resistin (RETN)
MBS2131701-01 0.1 mL

Cy3 Linked Polyclonal Antibody to Resistin (RETN)

Sign In for Pricing
View Details
Cy3 Linked Polyclonal Antibody to Resistin (RETN)
MBS2131701-02 0.2 mL

Cy3 Linked Polyclonal Antibody to Resistin (RETN)

Sign In for Pricing
View Details
Cy3 Linked Polyclonal Antibody to Resistin (RETN)
MBS2131701-03 0.5 mL

Cy3 Linked Polyclonal Antibody to Resistin (RETN)

Sign In for Pricing
View Details