Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCT6B Rabbit Polyclonal Antibody (Biotin)

CCT6B Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Cctz2, CCTZ-2, TSA303, CCT-zeta-2, TCP-1-zeta-2

UniProt

Q92526

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CCT6B

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VARTSLQTKVHAELADVLTEVVVDSVLAVRRPGYPIDLFMVEIMEMKHKL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_006575

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Ring Finger Protein 4 ELISA Kit
MBS742766-01 48 Well

Sheep Ring Finger Protein 4 ELISA Kit

Sign In for Pricing
View Details
Sheep Ring Finger Protein 4 ELISA Kit
MBS742766-02 96 Well

Sheep Ring Finger Protein 4 ELISA Kit

Sign In for Pricing
View Details
Sheep Ring Finger Protein 4 ELISA Kit
MBS742766-03 5x 96 Well

Sheep Ring Finger Protein 4 ELISA Kit

Sign In for Pricing
View Details
Sheep Ring Finger Protein 4 ELISA Kit
MBS742766-04 10x 96 Well

Sheep Ring Finger Protein 4 ELISA Kit

Sign In for Pricing
View Details
Treponema pallidum Monoclonal Antibody
MBS320570-01 0.1 mg

Treponema pallidum Monoclonal Antibody

Sign In for Pricing
View Details
Treponema pallidum Monoclonal Antibody
MBS320570-02 1 mg

Treponema pallidum Monoclonal Antibody

Sign In for Pricing
View Details