Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Actl7a Rabbit Polyclonal Antibody (HRP)

Actl7a Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Tact, Tact2

UniProt

Q9QY84

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Actl7a

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VVPIYEGYPLPSITGRLDYAGSDLTTYLMNLMNNSGKHFSEDHLGIVEDI

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_033741

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Serine/arginine-rich splicing factor 1 ELISA Kit
MBS288094-01 48 Well

Bovine Serine/arginine-rich splicing factor 1 ELISA Kit

Sign In for Pricing
View Details
Bovine Serine/arginine-rich splicing factor 1 ELISA Kit
MBS288094-02 96 Well

Bovine Serine/arginine-rich splicing factor 1 ELISA Kit

Sign In for Pricing
View Details
Bovine Serine/arginine-rich splicing factor 1 ELISA Kit
MBS288094-03 5x 96 Well

Bovine Serine/arginine-rich splicing factor 1 ELISA Kit

Sign In for Pricing
View Details
Bovine Serine/arginine-rich splicing factor 1 ELISA Kit
MBS288094-04 10x 96 Well

Bovine Serine/arginine-rich splicing factor 1 ELISA Kit

Sign In for Pricing
View Details
LRTM2 (NM_001039029) Human Tagged ORF Clone Lentiviral Particle
RC223599L3V 200 µL

LRTM2 (NM_001039029) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Glutaminase Rabbit pAb
E53P04985 100 µL

Glutaminase Rabbit pAb

Sign In for Pricing
View Details