Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Actl7a Rabbit Polyclonal Antibody (HRP)

Actl7a Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Tact, Tact2

UniProt

Q9QY84

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Actl7a

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VVPIYEGYPLPSITGRLDYAGSDLTTYLMNLMNNSGKHFSEDHLGIVEDI

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_033741

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal MEPCE Antibody
NBP3-29493 100 µg

Rabbit Polyclonal MEPCE Antibody

Sign In for Pricing
View Details
IL2RG sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1075608 1.0 µg DNA

IL2RG sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
GPR87/95 Polyclonal Antibody
E44H06880 100 µL

GPR87/95 Polyclonal Antibody

Sign In for Pricing
View Details
TentaGel® MB Br
MB160001.100G 100 g

TentaGel® MB Br

Sign In for Pricing
View Details
Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2239 (AF_2239)
orb2925840-01 20 µg

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2239 (AF_2239)

Sign In for Pricing
View Details
Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2239 (AF_2239)
orb2925840-02 100 µg

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2239 (AF_2239)

Sign In for Pricing
View Details