Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPAG6 Rabbit Polyclonal Antibody (HRP)

SPAG6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Pf16, CT141, FAP194, CFAP194, Repro-SA-1

UniProt

O75602

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SPAG6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HVVGQFSKVLPHDSKARRLFVTSGGLKKVQEIKAEPGSLLQEYINSINSC

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036575

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zebrafish OPA1 Rabbit Polyclonal Antibody
orb2804664 100 µg

Zebrafish OPA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FOXO4 polyclonal antibody
BS90533 50ul

FOXO4 polyclonal antibody

Sign In for Pricing
View Details
(S) -Trolox (Standard)
HY-101445BR 1 Each

(S) -Trolox (Standard)

Sign In for Pricing
View Details
Mortars And Pestles, Glass
2065670/2 1 Each

Mortars And Pestles, Glass

Sign In for Pricing
View Details
TRIM5 (Tripartite Motif-containing Protein 5, RING Finger Protein 88, RNF88) (MaxLight 550)
134756-ML550 100 µL

TRIM5 (Tripartite Motif-containing Protein 5, RING Finger Protein 88, RNF88) (MaxLight 550)

Sign In for Pricing
View Details
Anti-MAPK6 Antibody, Rabbit Polyclonal
MBS8101438-01 0.1 mL

Anti-MAPK6 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details