Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STAG3 Rabbit Polyclonal Antibody (HRP)

STAG3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9UJ98

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human STAG3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VPHQVILPALTLVYFSILWTLTHISKSDASQKQLSSLRDRMVAFCELCQS

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

135kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036579

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HSPb8 ELISA Kit
E018049 1 Each

Human HSPb8 ELISA Kit

Sign In for Pricing
View Details
MBM-55 10mM * 1mL in DMSO
A12510-10mM-D 10 mM x 1mL in DMSO

MBM-55 10mM * 1mL in DMSO

Sign In for Pricing
View Details
Bcl-2 (Apoptosis Regulator Bcl-2, B Cell CLL/lymphoma-2) (BSA & Azide Free) (MaxLight 750)
MBS6236631-01 0.1 mL

Bcl-2 (Apoptosis Regulator Bcl-2, B Cell CLL/lymphoma-2) (BSA & Azide Free) (MaxLight 750)

Sign In for Pricing
View Details
Bcl-2 (Apoptosis Regulator Bcl-2, B Cell CLL/lymphoma-2) (BSA & Azide Free) (MaxLight 750)
MBS6236631-02 5x 0.1 mL

Bcl-2 (Apoptosis Regulator Bcl-2, B Cell CLL/lymphoma-2) (BSA & Azide Free) (MaxLight 750)

Sign In for Pricing
View Details
Cytokeratin 6 Mouse Monoclonal Antibody
orb323132-01 30 µL

Cytokeratin 6 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 6 Mouse Monoclonal Antibody
orb323132-02 50 μL

Cytokeratin 6 Mouse Monoclonal Antibody

Sign In for Pricing
View Details