Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SSX2IP Rabbit Polyclonal Antibody (HRP)

SSX2IP Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ADIP, hMsd1

UniProt

Q9Y2D8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SSX2IP

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KVHLEGFNDEDVISRQDHEQETEKLELEIQQCKEMIKTQQQLLQQQLATA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_054740

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCXR (L-xylulose Reductase, XR, Carbonyl Reductase II, Dicarbonyl/L-xylulose Reductase, Kidney Dicarbonyl Reductase, kiDCR, Sperm Surface Protein P34H) (APC)
125694-APC 100 µL

DCXR (L-xylulose Reductase, XR, Carbonyl Reductase II, Dicarbonyl/L-xylulose Reductase, Kidney Dicarbonyl Reductase, kiDCR, Sperm Surface Protein P34H) (APC)

Sign In for Pricing
View Details
EPB41L3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV653617 1.0 µg DNA

EPB41L3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Mouse CALCA / Calcitonin ELISA Kit
MBS2905680-01 48 Well

Mouse CALCA / Calcitonin ELISA Kit

Sign In for Pricing
View Details
Mouse CALCA / Calcitonin ELISA Kit
MBS2905680-02 96 Well

Mouse CALCA / Calcitonin ELISA Kit

Sign In for Pricing
View Details
Mouse CALCA / Calcitonin ELISA Kit
MBS2905680-03 5x 96 Well

Mouse CALCA / Calcitonin ELISA Kit

Sign In for Pricing
View Details
Mouse CALCA / Calcitonin ELISA Kit
MBS2905680-04 10x 96 Well

Mouse CALCA / Calcitonin ELISA Kit

Sign In for Pricing
View Details