Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCCPDH Rabbit Polyclonal Antibody (HRP)

SCCPDH Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NET11, CGI-49

UniProt

Q8NBX0

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SCCPDH

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FSFGYFSKQGPTQKQIDAASFTLTFFGQGYSQGTGTDKNKPNIKICTQVK

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_057086

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSC1, phosphorylated (S1080) (TSC1, KIAA0243, TSC, Hamartin, Tuberous sclerosis 1 protein) (MaxLight 650) discontinued
043310-ML650 100 µL

TSC1, phosphorylated (S1080) (TSC1, KIAA0243, TSC, Hamartin, Tuberous sclerosis 1 protein) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Beta Actin Antibody / ACTB
V9713SAF-100UG 100 µg

Beta Actin Antibody / ACTB

Sign In for Pricing
View Details
Cellular Retinoic Acid-binding protein 2 (CRABP2) Mouse ELISA Kit
C2775 96 Tests

Cellular Retinoic Acid-binding protein 2 (CRABP2) Mouse ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Mrm1 shRNA (UAS) - Lentiviral mouse Mrm1 shRNA (UAS) plasmid
GTR15118855 1 Vial

Lentiviral mouse Mrm1 shRNA (UAS) - Lentiviral mouse Mrm1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Anti Human IL-2 Flow Cytometry Monoclonal Clone MQ117H12 APC  Ready To Use 100 Tests
IRTAHUIL2MQ117H12CAPC100 100 Tests

Anti Human IL-2 Flow Cytometry Monoclonal Clone MQ117H12 APC Ready To Use 100 Tests

Sign In for Pricing
View Details
Recombinant Human C-C motif chemokine 21 protein (CCL21)
MBS9422906-01 0.005 mg

Recombinant Human C-C motif chemokine 21 protein (CCL21)

Sign In for Pricing
View Details