Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OAZ3 Rabbit Polyclonal Antibody (HRP)

OAZ3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AZ3, OAZ-t, TISP15

UniProt

Q9UMX2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human OAZ3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DRRLFLDIPYQALDQGNRESLTATLEYVEEKTNVDSVFVNFQNDRNDRGA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057262

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal LAMP-1/CD107a Antibody (107) [DyLight 680]
NBP2-89844FR 0.1 mL

Rabbit Monoclonal LAMP-1/CD107a Antibody (107) [DyLight 680]

Sign In for Pricing
View Details
Mouse Ankyrin repeat domain containing protein 55 (ANKRD55) ELISA Kit
GTR10351328 96 Well

Mouse Ankyrin repeat domain containing protein 55 (ANKRD55) ELISA Kit

Sign In for Pricing
View Details
Recombinant Debaryomyces hansenii GPI mannosyltransferase 2 (GPI18), partial
MBS7085058 Inquire

Recombinant Debaryomyces hansenii GPI mannosyltransferase 2 (GPI18), partial

Sign In for Pricing
View Details
DZIP3 Rabbit Polyclonal Antibody (BF350)
orb1594952 100 µL

DZIP3 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
RGS10 (NM_001005339) Human Untagged Clone
SC300912 10 µg

RGS10 (NM_001005339) Human Untagged Clone

Sign In for Pricing
View Details
Monoclonal Antibody to Leukocyte Associated Immunogloulin Like Receptor 1 (LAIR1)
MBS2152294-01 0.1 mL

Monoclonal Antibody to Leukocyte Associated Immunogloulin Like Receptor 1 (LAIR1)

Sign In for Pricing
View Details