Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPA17 Rabbit Polyclonal Antibody (HRP)

SPA17 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CT22, SP17, SP17-1

UniProt

Q15506

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SPA17

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_059121

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein kinase Y linked Overexpression Lysate (Native) - (Dry Ice)
NBL1-14788 0.1 mg

Protein kinase Y linked Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
HK-2 Cells
BC1016-1 1 Vial (1x 10^6 Cells/Frozen)

HK-2 Cells

Sign In for Pricing
View Details
Dog C-C Motif Chemokine 3 (CCL3) ELISA Kit
abx150276-01 96 Tests

Dog C-C Motif Chemokine 3 (CCL3) ELISA Kit

Sign In for Pricing
View Details
Dog C-C Motif Chemokine 3 (CCL3) ELISA Kit
abx150276-02 5x 96 Tests

Dog C-C Motif Chemokine 3 (CCL3) ELISA Kit

Sign In for Pricing
View Details
Dog C-C Motif Chemokine 3 (CCL3) ELISA Kit
abx150276-03 10x 96 Tests

Dog C-C Motif Chemokine 3 (CCL3) ELISA Kit

Sign In for Pricing
View Details
1-Tert-Butyl 2-Ethyl 5-Oxopyrrolidine-1,2-Dicarboxylate
OR1009591-01 1 g

1-Tert-Butyl 2-Ethyl 5-Oxopyrrolidine-1,2-Dicarboxylate

Sign In for Pricing
View Details