Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPA17 Rabbit Polyclonal Antibody (HRP)

SPA17 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CT22, SP17, SP17-1

UniProt

Q15506

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SPA17

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_059121

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fast Plus EvaGreen® qPCR Master Mix with low Rox (500 rxn)
#31014-1 5x 1 mL

Fast Plus EvaGreen® qPCR Master Mix with low Rox (500 rxn)

Sign In for Pricing
View Details
Human Gastrin Releasing Peptide (GRP) ELISA Kit
orb2813453-01 48 Tests

Human Gastrin Releasing Peptide (GRP) ELISA Kit

Sign In for Pricing
View Details
Human Gastrin Releasing Peptide (GRP) ELISA Kit
orb2813453-02 96 Tests

Human Gastrin Releasing Peptide (GRP) ELISA Kit

Sign In for Pricing
View Details
Human Gastrin Releasing Peptide (GRP) ELISA Kit
orb2813453-03 5 x 96 T

Human Gastrin Releasing Peptide (GRP) ELISA Kit

Sign In for Pricing
View Details
DNAJC5G Polyclonal Antibody, APC Conjugated
bs-14394R-APC 100 µL

DNAJC5G Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Rad9, phosphorylated (Ser277) (RAD9A, Cell Cycle Checkpoint Control Protein RAD9A, hRAD9, DNA Repair Exonuclease Rad9 Homolog A) (APC) discontinued
R0444-67C-APC 200 µL

Rad9, phosphorylated (Ser277) (RAD9A, Cell Cycle Checkpoint Control Protein RAD9A, hRAD9, DNA Repair Exonuclease Rad9 Homolog A) (APC) discontinued

Sign In for Pricing
View Details