Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Spa17 Rabbit Polyclonal Antibody (FITC)

Spa17 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Sp17

UniProt

Q9Z1K2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Spa17

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AYFENLLEKREKTSFDPAEWGAKVEDRFYNNHAFKDPEQAEKCEQEIAKA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_445934

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OTUB2, NT (OTUB2, C14orf137, OTB2, OTU2, Ubiquitin thioesterase OTUB2, Deubiquitinating enzyme OTUB2, OTU domain-containing ubiquitin aldehyde-binding protein 2, Otubain-2, Ubiquitin-specific-processing protease OTUB2) (MaxLight 550) discontinued
039536-ML550 100 µL

OTUB2, NT (OTUB2, C14orf137, OTB2, OTU2, Ubiquitin thioesterase OTUB2, Deubiquitinating enzyme OTUB2, OTU domain-containing ubiquitin aldehyde-binding protein 2, Otubain-2, Ubiquitin-specific-processing protease OTUB2) (MaxLight 550) discontinued

Sign In for Pricing
View Details
IL-19 Protein, Human, Recombinant (His Tag)
PH50508M2-01 50 µg

IL-19 Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
IL-19 Protein, Human, Recombinant (His Tag)
PH50508M2-02 1 mg

IL-19 Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
MPP5 (NM_022474) Human Recombinant Protein
TP324752L 1 mg

MPP5 (NM_022474) Human Recombinant Protein

Sign In for Pricing
View Details
CASC5 Protein Vector (Rat) (pPB-N-His)
PV257579 500 ng

CASC5 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Emx1 (NM_010131) Mouse Tagged Lenti ORF Clone
MR222943L3 10 µg

Emx1 (NM_010131) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details